SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002058574.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002058574.1.90633
Domain Number 1 Region: 86-149
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000706
Family Tachycitin 0.015
Further Details:      
 
Domain Number 2 Region: 21-88
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000915
Family Tachycitin 0.017
Further Details:      
 
Domain Number 3 Region: 156-220
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000628
Family Tachycitin 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002058574.1.90633
Sequence length 256
Comment uncharacterized protein Dvir_GJ14495, isoform A [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MKKFIVVFVALFGAAVAQQSFKCPDDFGFYPHETSCDKYWKCDNGVSELKTCGNGLAFDA
TDSKFLTENCDYLHNVECGERTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRY
QCSPGLAYDRDARVCMWADQVPECKNEEVANGFACPAAGELANTGSFSRHAHPEDCRKYY
ICLEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDVPGCEDYYGDLDLKSIRKSELLAGLN
TEGRTKSAPKTKAATS
Download sequence
Identical sequences B4MBS1
XP_002058574.1.90633 FBpp0228912 7244.FBpp0228912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]