SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002059336.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002059336.1.90633
Domain Number 1 Region: 244-510
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-81
Family Protein kinases, catalytic subunit 0.0000000206
Further Details:      
 
Domain Number 2 Region: 131-274
Classification Level Classification E-value
Superfamily SH2 domain 6.4e-42
Family SH2 domain 0.0000283
Further Details:      
 
Domain Number 3 Region: 51-141
Classification Level Classification E-value
Superfamily SH3-domain 2e-25
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002059336.1.90633
Sequence length 523
Comment uncharacterized protein Dvir_GJ17854, isoform A [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MGNCLRTQKPDNDKPHAGDVRNPLDDPGASIGVVGVGVGVPQIAMPMPGQPAEQIRPVPQ
IPESDAANANAKIFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKKTRQEGYI
PSNYVAKLKSIEAEPWYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSVRDGD
TVKHYRIRQLDEGGFFIARRTTFRTLQELVEHYSKDSDGLCVNLCKPCVQIEKPVTEGLS
HRTRDQWEIDRTSLKFVRKLGSGQFGDVWEGLWNNTTPVAIKTLKSGTMDPKDFLAEAQI
MKKLRHTKLIQLYAVCTVEEPIYIITELMKHGSLLEYLQAIAGKCRSIKMQTLIDMAAQI
AAGMAYLESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIKEDEYEARVGARFPIKWTA
PEAANYSKFSIKSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPMPPNCEQR
LYEIMLECWHKDPMRRPTFETLQWKLEDFYTSDQSDYKEAQAY
Download sequence
Identical sequences B4KSC5 B4MDY3
FBpp0169169 7244.FBpp0232271 FBpp0232271 XP_002004472.1.58863 XP_002059336.1.90633 XP_017867762.1.65068 XP_017960853.1.46654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]