SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002071162.1.14588 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002071162.1.14588
Domain Number 1 Region: 33-209,255-365
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.43e-45
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002071162.1.14588
Sequence length 367
Comment uncharacterized protein Dwil_GK25282 [Drosophila willistoni]; AA=GCF_000005925.1; RF=representative genome; TAX=7260; STAX=7260; NAME=Drosophila willistoni; strain=TSC#14030-0811.24; AL=Scaffold; RT=Major
Sequence
MSTLSRPKSPHTPTTTKKGREEDSFWDKFSTLGRKRGTREVKKIQEEGKYAIDSPGSPNQ
YDIPPEDYALREHEQRAVIDPQSINDPEVVKLQRILVDWINDELAEQRIIVQNLEEDMYD
GQVLHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIVLKAVNHTLGFHQKIPKWSVASVHSK
NIVAILHLLVALVRHFRAPVRLPENVFVTVVIAEKNAGVLNAQKFQEQITSEYDDLGMRC
EKDAFDTLIDCAPDKLAVVKKSLITFVNKHLAKLNFEITDLNTDFRDGVYLCLLMGLLGG
FFVPLHEFHLTPQDVDQMVNNVAFAFDLMQDVGLPKPKARPEDIVNMDLKSTLRVLYSLF
TMFREYA
Download sequence
Identical sequences B4NEH9
FBpp0254425 7260.FBpp0254425 XP_002071162.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]