SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002088462.2.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002088462.2.41174
Domain Number 1 Region: 899-1044
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.62e-35
Family Toll/Interleukin receptor TIR domain 0.00047
Further Details:      
 
Domain Number 2 Region: 185-431,560-662
Classification Level Classification E-value
Superfamily L domain-like 8.93e-22
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 3 Region: 703-836
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000295
Family Ngr ectodomain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002088462.2.41174
Sequence length 1057
Comment uncharacterized protein Dyak_GE12336 [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MLEVLQMFKGVHCSKQLDNIRKDYCEIYFGEFAENRSCSITDNIVTTEDYQMSLVFSTLK
INWTSPVFHRWNIYKICNETDYELVKIAVHGIRSGVDMRIGPGVHYLGLLGIRESVGYDI
YLPSLLITETDVHYANGPQILTFKYVYDSPLNSMIINNYIRKTMNDTKQIKIHNPNTFEK
PTLTVEENVFYGKYNLSGVTFTGLNVEGLTAKTFENLASISRLNFDNAVLKDLSFLRSST
LQESLTYCIMKVASVVDLKNFDKFTNLEAIELNRYKSFKNFTAVICEPYKSYCKFTFGIN
KVACPFQCSCTYDRDNSRLEIDCRQKDLTSIPSLPVSKKGYSILVFQSNRLAELPYKSLE
GYKNIKSLDVSYNQLASLSVSQLPKSLYYLDIRHNNITTLSPQVVEYLHKVNTFNQFGNK
WIIYCDEYNLQDFFWNKAKLIRIIASKFDAIMDYMEVGSKGAYLSYFFAENIDHLYLEAH
EDDIIGALSSSDIYFDLKIMEALNHVIWLFSGEYDEIILHHLNAPCPYRCSCCFERQTGE
FFINCQNLTLDFYPRLPNSMPNNTTLYLDANEISKLTNPDNIIVTGHASIQKLHMSQNLL
RELPLHLLPENITYLDVRNNLLRYLDDGVVAFLEYRENITQIELSGNPWECNCRAKTFLS
YLRKHEPMEYETVLQRVNITQDKCPADCICCVDTSNSESLTLMIDCSGKKLREVPPLPTP
ALGQTTLIFERNNLEKWPSCLLPGYSSVTRFYLANNRLSDIDQLPEKLLHLDISNNNFSA
LDNRVRGFLQKRMNSSQMKLSLFGNPWTCSCKEKDFLVFVKAQVKNIANASAIQCIGTGR
SLIEIDETDICPSVLIYYTSLAVSLLIIAVSTNVFICFRQPILIWFYEHEICLSLAARRE
LDEDKKYDAFLSFTHKDEEFIEEFVDRLENGKHKFRLCFYLRDWLVGESIPDCINQSVKD
SRRIIILMTKNFLQSTWGRLEFRLALHATSKDRCKRLIVVLYPDVENFDDLDSELRTYMV
LNTYLERNNPNFWNKLIYSMPHDLHSKRRRSDAETKV
Download sequence
Identical sequences B4P203
XP_002088462.2.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]