SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002093190.1.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002093190.1.41174
Domain Number 1 Region: 57-130,161-240,286-346,400-447
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.64e-23
Family Ankyrin repeat 0.007
Further Details:      
 
Domain Number 2 Region: 622-669
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000101
Family SOCS box-like 0.0082
Further Details:      
 
Weak hits

Sequence:  XP_002093190.1.41174
Domain Number - Region: 412-535
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0373
Family Ankyrin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002093190.1.41174
Sequence length 671
Comment uncharacterized protein Dyak_GE20917 [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MGGSVSQVFRSGSALLSHRDGKLSKATEETIQTLFDILRANPKVSLQTLESLLIQIPKNE
NILAMHDDYGYNILQRSVGLNHIDLTKWLLHRHRPDVNRSPCSLPLHIATLRGYEECVEL
LLRHGARIDVDTRMCFPGAHTRNCEESGKWHNNVDDVSERLNTKLQNALFYAIDGDQYNV
LSLLTQKMEEPWIPFRVKKPLLHLACERGAWNCVQQLVVTRSEEINLIMDEYYPIHHAVL
HDGRFLELLIHQGAITTVRTCTQQMTLLHVVIFAARKSAEDTLATLRILLERGCKELINA
PDSLGNTPLHALIVRYALEEARYGYDKWSKWDVLHLVRFLLQNGAKQSINQAGNSAMACV
FRHLRDWEVCYELLSMLIKENGDPNIVGRDGSVPIMVLLVPLINKDHLHHFTHSMKVCYL
NCIRMLLQHGANPNCSYRANLKPLHVLVFTVSENFTLNCDAQKRTNFDFIKNILLMLLQH
GLDCNKTYQHILQAVMDMVHNVRTCHDMECVYELTLTLIQYGADPNIVLSGKTTPGTAIF
SNELATFRSSFRTNSCYLLFYYIILITKKEFILNDPHATYTRVIHLFYLTMHHEPLFNCL
KSLHNFYVAQVPSKKTEQLIALISSLYRRPRSLKQLSRWAIYEAMNRKLAQNINCLNLPG
PLKDYVLQFER
Download sequence
Identical sequences B4PDT7
XP_002093190.1.41174 7245.FBpp0265927 FBpp0265927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]