SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002096216.1.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002096216.1.41174
Domain Number - Region: 149-192
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0122
Family SNARE fusion complex 0.011
Further Details:      
 
Domain Number - Region: 57-115
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0683
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002096216.1.41174
Sequence length 232
Comment uncharacterized protein Dyak_GE25547, isoform A [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MGGSSYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPLLGEHVFDSLS
EEIEQMLEKLSSLNESMSDLPSSGAAALHTLQRHREILQGYRQEFNKICANHTMRIEREE
LLRGSGLATSSGSPSISGLNRREMYLKESGHLNSASHLVNDQINIAIETRDHLHAQRQAF
KRLQTRFNDISNRFPLISSLIQRINIKKRRDSLILGAVIGFCVILLLLYAFN
Download sequence
Identical sequences B4PLZ6
XP_002096216.1.41174 FBpp0270557 7245.FBpp0270557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]