SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002097850.1.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002097850.1.41174
Domain Number 1 Region: 615-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000443
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 339-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000145
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 668-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000253
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 532-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000903
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 473-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000984
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 7 Region: 586-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000236
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  XP_002097850.1.41174
Domain Number - Region: 422-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00012
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 1255-1281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00499
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002097850.1.41174
Sequence length 1282
Comment uncharacterized protein Dyak_GE26438, isoform A [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MNNQRYGGIQWIQHHVSAGDSSEVDILESDGGAGASGEDLDHMAAENLIFMARDGQLSEI
MAANEAGRTVLVTADGTTVAYAESFDDDAQVVTEEVITDDWVQHQGAERVEIAAEQIAGI
SSSQELLDMEQDEYTALRPYPCDFCSRRFRKKATLNNHMLAHQNDRPHLCKLCGARFSRR
AELISHFKAHAEAQDAADAEAAAAAADSSSAIKFEHQTQRQMDDHYYEQDWPLFQQQQEQ
EQAQQEIHQQHQIVEEGEVQLVASYPATVAPPVAPSRGRISRLKPKEESSQFIVISDKSA
GDSGAYMEPEPAQPVVTTSQPIAIDPPPQPNFPVLDDSKPFVCQQCGLAFAREKALVSHT
KNHRVDSPFECNQCQEMFWDNTSLQEHQKTHQFEESNSEYDPASAEDSGSESEPDEQLYG
EFYCNECGISFHRQDLLRRHAKLHYKPTDQAAGGSNSDVTAGGDEEHAKDSTGHCCNTCG
KSFPSALEMLAHAEIHARFPPFKCVLCGISFYEEQAIKRHLHTRHPSELKANSCVLCGKE
CRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCQEEFPDGR
TLSNHRHSHSTTSPGKLFPCHECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGT
LRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDVARNTYHCTVCSEDLSTSN
DLIQHLIQHSDSNTAKQRQPVTGPRKYKRRRKLQPHEIAHMRAENKDGNGEEEEAVGEGD
AEEYASDIDLCDFDVENVDDLFDMAESPKKEKRKRGSTATKADPKAMTNGKAVKPSQDKG
KAKPRYDSISSQQSDRIWEEKFLHDSQVALFQIDSLVVVNDTHLQPASSAVSSNIPNTRG
GLKQQGKVQAKSADGAGNFNSLATTSVPSLSSSTSASSSRSRKRAATTKTASKAPPASNS
RPRMIHTEKAKVPRGVGGDSSSISVKKTRSKTYISRTESNNLSLDKSRSSASNMVDDYEI
ISPATHPPNQISSSPLHIKQEQEQQQRVQLMYDDNLLIDAALLREKTYEKFNPSIVNDLE
EILRSPLKHERNSRLRFTSESSTTPQYLPEEEQNLIKIEPTSPDLREMLESQQRVTAHSG
GTPSSSSSARTSRHLRQITANGARAGSKRSLGGVASKSSPVAGVVAKKANTATKVSSSSS
SYLSYGVDSYNVNVPASANNTDVGSGFFSISEVVSAADAADAAAKAAAAGKSERKTRSFE
CEMCSAIFYDRAQLLEHVHIHI
Download sequence
Identical sequences B4PSR6
7245.FBpp0271448 XP_002097850.1.41174 XP_015048269.1.41174 FBpp0271448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]