SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002099181.1.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002099181.1.41174
Domain Number 1 Region: 638-752
Classification Level Classification E-value
Superfamily Bromodomain 4.58e-31
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 507-618
Classification Level Classification E-value
Superfamily Bromodomain 2.35e-30
Family Bromodomain 0.00022
Further Details:      
 
Domain Number 3 Region: 192-295
Classification Level Classification E-value
Superfamily Bromodomain 2.62e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 3.53e-24
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 5 Region: 367-445
Classification Level Classification E-value
Superfamily Bromodomain 3.92e-18
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 6 Region: 1302-1374
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000144
Family HMG-box 0.0013
Further Details:      
 
Domain Number 7 Region: 761-866
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000209
Family Bromodomain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002099181.1.41174
Sequence length 1653
Comment uncharacterized protein Dyak_GE10775 [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPTELCQQLYDSIR
NIKKEDGSMLCDTFIRVPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYTPSSSEHQDAVSLWQHIQSQRQRIMEANGLAEEEPRARRMSRQVRRMTSST
EPGGDGANDDEYNQYEELFASVMTATDPVGDRSMHRMFQLLPSKKIYPDYYDVIEHPIDL
RLIATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIELETG
KGKLAKRIKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTG
PPLGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAKK
AFPTSHRTHKDALKMLKLMNAKLVEESLEEGSDLDDEDADDIDAEVFTVATQPEKRKPGR
PRVNSNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSLGNRRPIEMFMEK
PPRKIYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIYE
DANILERALNEKLKEFPGLTEGKKTQQKYSKVGRKLKTALITERLWQFYETVKEYQEPKG
KRQLSLIFTKLPSKSEYPDYYDIIREPIDMDRIAQKLKQGAYETLDDLAADFLLMLENAC
KYNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLAVQELFLTLFTTIYNHQDEEG
RCYSDSLAELPEYDEIGEGPKVRGISLDLVKRRLDKGAYKRLDVYQEDIFACLERARKLS
RTDSDIFQDSIELQTYFIRKRDELCKDTLSSSALNFSLERLMADVELCRQQKMQQEEQDQ
EQDKEKDEFNAAKGESMTINQQVFSPGDYVYVQMPENKIPSICCIERLWTSPTNEKLMQA
SIFVRPHETYHVTTRKFLEKEVFKSSLSQTISMDKVLGMCYVMNIKDYIKMRPENLPEKD
VYVCESRYNIQGRWFKKLKNWPPVREGSSVKFVPREQPLELKRVMSVFKERLEKHKGELE
ELKLQETLVEKEKPNVSCDPPPNSEGGTTYYQQYNTICSGAIKTGDFVYVATQTGKQSVA
QVQQIWEQNGKSYFKGPWLLPPSETTPGLGKQFYRQELLMSTVEEVSPVVGIVGRCAVLE
YSEFISSRPTEISESDVYICESVYDELKKALRKLVTGNMRKFQHSPSVTEDEIFYFKTPI
KPTKDVKSELNELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKVKAAKSAKKCL
TGYILYSSEVRKGICQSNPDATFGDISRMVGTEWKNLPSSVKQSWEDRASRQNEETAALR
RELDDVQNSASPSPQVSQDVFGQVVTFECQWDKCDFQFEELGDCTEHCMSDSTGHIQRHP
QAGVETEYVCLWRNCPRIKKSVQAFPNVLRLIKHVREVHLSKCGKTISTADRSKNFVPRR
QKHAQLATTVPIPPSLAQSPRAPSNLEAVQLQQQHPQQNIHQLQQQQTIVLGPPPEPLFV
TVPPRTTRVIHSEAYIKYIESLQTGSHLNVATCNNNWRRALNHITPAQVVAKAPLPEQWI
GPNLRDQSNVVQALCHLRNFMVDDILQIRRSCN
Download sequence
Identical sequences B4PV44
7245.FBpp0255785 XP_002099181.1.41174 FBpp0255785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]