SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002108700.1.101920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002108700.1.101920
Domain Number 1 Region: 122-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000206
Family MAM domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002108700.1.101920
Sequence length 194
Comment predicted protein [Trichoplax adhaerens]; AA=GCF_000150275.1; RF=representative genome; TAX=10228; STAX=10228; NAME=Trichoplax adhaerens; strain=Grell-BS-1999; AL=Scaffold; RT=Major
Sequence
MINYDEKVDRPSLHGFSFSCPDTVRNSQHQRCQNHGNQVLLCDTLDAALRKKNEWTGFNQ
IILKDTTLDCHDCKLQRIVEWKNQPSHSLIGRCRLSENQLLNLQLLRKSDLRCRKIDSGT
IAAACDFRSNFCKFSQEKSSDDLDWARVSGTKHDGTTGHYAYLASSQSLSNHFAQLLSPV
VELPNNVQEFRVSF
Download sequence
Identical sequences B3RL70
XP_002108700.1.101920 10228.JGI51899 jgi|Triad1|51899|fgeneshTA2_pg.C_scaffold_1000646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]