SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002111221.1.101920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002111221.1.101920
Domain Number 1 Region: 27-133
Classification Level Classification E-value
Superfamily PH domain-like 2.99e-30
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 200-296
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000641
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002111221.1.101920
Sequence length 406
Comment hypothetical protein TRIADDRAFT_54960 [Trichoplax adhaerens]; AA=GCF_000150275.1; RF=representative genome; TAX=10228; STAX=10228; NAME=Trichoplax adhaerens; strain=Grell-BS-1999; AL=Scaffold; RT=Major
Sequence
MPPATNRNIPSKILTEEENRVIFDILASQKCTTLATTVVQVQLAQPNPSSWTKKCTGVLC
LVKDYAVKSYFLRVYSPVGKTLLWEQEIYLNFQYKKSTEYFHTFQAHDCTAGFNFADTDE
AASFYLTLTNKLKLKKEKNATVSRSKQKNKHQQPISNKPLDTYVRKDSAQVKSLNLSHNK
RRPRDKGGKKLTKLDISQPTEFRHLKHVGWDENSKSLVEEVSEEWKDLYSSIGLTTADLH
DENIMQMVHKVVEQRGGIEKANKEITLRRQRPSLSRPSLPPVHGSPAPCPPPPPCLPSLP
GPIPIPIPASLPPYSSSRSPSPPLPSPPPLPVPPVSEPRESLFDQIHRGIELRKVHNTEE
MKKKAPPLAEESSIITALDKELARMNPRVQRSDSESSDGSDWDDMD
Download sequence
Identical sequences B3RTG8
XP_002111221.1.101920 jgi|Triad1|54960|fgeneshTA2_pg.C_scaffold_3000967 10228.JGI54960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]