SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002113907.1.101920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002113907.1.101920
Domain Number 1 Region: 67-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000655
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 107-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000937
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 3 Region: 30-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000313
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 1-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000178
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002113907.1.101920
Sequence length 166
Comment hypothetical protein TRIADDRAFT_27555, partial [Trichoplax adhaerens]; AA=GCF_000150275.1; RF=representative genome; TAX=10228; STAX=10228; NAME=Trichoplax adhaerens; strain=Grell-BS-1999; AL=Scaffold; RT=Major
Sequence
CASNPCLYNGICSPECQCFPGYFGNRCQFFNHCQNLPCSNNGTCEVVGFEYRCHCRPEYY
GKNCEHERNECASNPCSNGATCANMFYGYKCLCPPNYTGTLCQDYYVDTCSSNPCQNGAT
CLKKKQGYECICGELETGRHCETSMLQFIDIIDERKSLKNYYSSFS
Download sequence
Identical sequences B3S1F3
10228.JGI27555 XP_002113907.1.101920 jgi|Triad1|27555|e_gw1.7.796.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]