SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002114790.1.101920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002114790.1.101920
Domain Number 1 Region: 273-346
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00032
Further Details:      
 
Domain Number 2 Region: 107-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.94e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 21-95
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002114790.1.101920
Sequence length 360
Comment hypothetical protein TRIADDRAFT_28388 [Trichoplax adhaerens]; AA=GCF_000150275.1; RF=representative genome; TAX=10228; STAX=10228; NAME=Trichoplax adhaerens; strain=Grell-BS-1999; AL=Scaffold; RT=Major
Sequence
MNISCQRRHTEIIKDNSSGDKVVLKLLIPNYAAGSIIGKGGDVINDLQNDSKTRIRLSHN
NDTFPGTKERVIVITGSIAGVRQVNRFILEKVSEEGKADKAIQYGVLDKNRNRQLKMIVP
NAAAGVIIGKGGSNIKEIQDKSGAHVQVSQKKAQYAIDERILTVTGEFNERLTAWELIIW
KCLEDINNLPNTSVSYSHVEPAGTLPALHSNYYGGGNANDRPMDSSAASYDPYTSERYSP
TQVTQDAQADRQYGMQSYPPTARNNRPSSYGETVIKIPVPDSIIGAILGKRGKVISDIQN
ISGAHIQVSQRGDYIPGTKDREVTVTGTNDAAHYADKLIKGYLDKEYKKQASNFVSPQNY
Download sequence
Identical sequences B3S381
10228.JGI28388 XP_002114790.1.101920 jgi|Triad1|28388|e_gw1.8.296.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]