SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002123976.3.78797 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002123976.3.78797
Domain Number 1 Region: 377-587
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-52
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 70-150
Classification Level Classification E-value
Superfamily BRCT domain 1.34e-16
Family DNA ligase 0.026
Further Details:      
 
Domain Number 3 Region: 169-255
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000393
Family DNA topoisomerase II binding protein 1, TopBP1 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002123976.3.78797
Sequence length 944
Comment PREDICTED: protein ECT2 isoform X2 [Ciona intestinalis]; AA=GCF_000224145.2; RF=representative genome; TAX=7719; STAX=7719; NAME=Ciona intestinalis; AL=Chromosome; RT=Major
Sequence
MKLDIPYLTSVDGMEYAEEEDPYYETVFIMDEFNGETFNDLKNNDCRILGAPVINTIMAT
NEPLPYTSRPLYCTLMQSLNLCFTNFKTKEHLAHLVTLCHYMGACIRKDMSSKIDFLVTN
TLHGPKYRTAVSLGTPVMKEEWIHRCWAARNRDQPCRATDDEFLVPCKSKPFEGCTLSFL
GFSECEKNHMQEQAREQGGLVAEVGDPICSHLVVDESSVVSLPFQPQGKLYMVVQEWFWG
SIQIEAKAAESMYVFQLVECPARMTRSSTTSSLLGTPKWKGSTRGLSMRQTGSSGKPSFS
RKRSRIREETLAKLAQETDVNNSHSLPPRKRQSTDTSACISESMLDISSSTNTGVLLPRS
KEDILREKIAGPVPVVTARYQVVMELLQTEKNYVGILQTILNLFKKPLDDPHQAGGPILA
SEDVKVIFSSLPDIEVVHRNMSDDLQLAIDQWNDSSCIGQLILKYADEFGRCYPPFVNFF
EASVETLSSCETRSPRFHAFLKINQAKRECGRQTLAELLINPVQRLPRIILLLQDIKKHT
EKENPNHPDVQNIQSSIDALKEVMTHINEDKRKTESQRQIFDIVYEVEGCPPTIVSSHRQ
FVARAEVIAVDDNLCNKGDHITFFIFSDCMEIAKRRRGIKSQSFKSPNVHGRPASVKCLK
HTKLLSLSHIKKVVSITDSEDCQNAVSLFCRTPTDTQDWLYTFKVMTCTEDSISNSKDEV
VTSGKENIANCSKSRLLQILSKHRANTVCKASDENFICCVNSQDLEVCTADLGSTLGRAV
RAAKKSSRKLTRAFSFSRTPRRVMQRAVTNMLSPSQQRPPTGLNQDDSPNCNGLSDVNDD
AKDNTRSLRVESLCTPQRNRRGNRLGSTTSLQHDESQEFTTYTMKPSVSTMTLAHPPSAA
DLIEFPAIPTPPTRRRRQKIVKAATVAFGRTGSFRKRVKAETAV
Download sequence
Identical sequences A0A1W2W4R9
XP_002123976.3.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]