SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002142145.1.43237 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002142145.1.43237
Domain Number 1 Region: 366-411
Classification Level Classification E-value
Superfamily RING/U-box 8.35e-18
Family RING finger domain, C3HC4 0.0082
Further Details:      
 
Domain Number 2 Region: 201-277
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 4.58e-17
Family Cdc48 domain 2-like 0.0007
Further Details:      
 
Weak hits

Sequence:  XP_002142145.1.43237
Domain Number - Region: 143-196
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.00719
Family Cdc48 domain 2-like 0.0066
Further Details:      
 
Domain Number - Region: 8-82
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0252
Family Cdc48 domain 2-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002142145.1.43237
Sequence length 413
Comment zinc finger, C3HC4 type domain-containing protein [Cryptosporidium muris RN66]; AA=GCF_000006515.1; RF=representative genome; TAX=441375; STAX=5808; NAME=Cryptosporidium muris RN66; strain=RN66; AL=Scaffold; RT=Major
Sequence
MYESTENPRYLAKIQLLPWAEQLDVDSLLRSMREYEVTKRVIRPYNRIYINKTKYYVVLF
CDPEEGGILTEHTQVYTNGKPIVPLKKVHFLALPPFNASTSPLAQRVTTIRLNRGIQEEA
NTVPETCDISIDDINTLCDRDTLCKLYVEPYFKKCRKEPVYVGRRINMEGIVFLVWACDP
CQIGVINKNTAVYIDWDCFGEFKRIHVMPFSDTLPQTYSYDIFQDYLKPFLSRYTFHPFC
QGESFTYNGVQFKVVATDPVGVKARIGDNTTIFCQGSLTPSIVDLLPIHLLENITRLPPR
SRPFAILQALTHLPPSDVDRIFGMADANNNRGVNNDVILTISQKAFIYHSQLQVGSNSEP
SDEPPMCTVCLSEVNNGENVVKLNCQHLFHLQCIQEWLRMSVICPLCKVDVRS
Download sequence
Identical sequences B6AHV5
gb|CMU_028700 gi|209557751|gb|EEA07796.1| gi|209881414|ref|XP_002142145.1| XP_002142145.1.43237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]