SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002165254.2.79663 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002165254.2.79663
Domain Number 1 Region: 3-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000288
Family EGF-type module 0.047
Further Details:      
 
Weak hits

Sequence:  XP_002165254.2.79663
Domain Number - Region: 36-117
Classification Level Classification E-value
Superfamily PKD domain 0.0628
Family PKD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002165254.2.79663
Sequence length 198
Comment PREDICTED: uncharacterized protein LOC100198726, partial [Hydra vulgaris]; AA=GCF_000004095.1; RF=representative genome; TAX=6087; STAX=6087; NAME=Hydra vulgaris; strain=105; AL=Scaffold; RT=Major
Sequence
NAGCEKDLCLNNSTCVPNYNDDSSTCKCLSSNFDGTFCERGLKVVLLRYSRQYSYGVPVQ
AFIQEANFKQKSGFSSSSCLLTFNDGGSISNNLGGQAFAYFVPPETGTYYFTITCSYHCV
LYVSTFGKQDRRMYLSAPSIKSPGIYIEKNKKIFLEMLIAIPTAVYGNAYGTSFSLTVTF
PNGTISNPVDNQYLASIF
Download sequence
Identical sequences gi|449687116|ref|XP_002165254.2| XP_002165254.2.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]