SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002168681.2.79663 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002168681.2.79663
Domain Number - Region: 43-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.000424
Family Cadherin 0.032
Further Details:      
 
Domain Number - Region: 133-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002168681.2.79663
Sequence length 275
Comment PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Hydra vulgaris]; AA=GCF_000004095.1; RF=representative genome; TAX=6087; STAX=6087; NAME=Hydra vulgaris; strain=105; AL=Scaffold; RT=Major
Sequence
DNSCKINEYCFATNDPNPKQWCEVCNPVKSRTSFSERTNNIAPWFKKVITKQYAFKGQQW
IYDIPAYDPENQPLLYKFEGESHGMKISTAGILTWNPNRIGSFIFTVKVTDPCGLSAFSK
FEVETKQCACEGKNGGICIWQGDPGNINSSICQCPNGCTGELCAEQIDGLICRIKIKNED
TKKLKDLSDTTLVIIIVFSVLLIAIFSVSGYMFLLKRKKILIKQPKDANVSSNQSGCESG
ILMTNIKSCDNGYENEAFVKNEINSTEKRKQDREA
Download sequence
Identical sequences gi|449676186|ref|XP_002168681.2| XP_002168681.2.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]