SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002171476.1.46972 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002171476.1.46972
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.29e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 77-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.19e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002171476.1.46972
Sequence length 228
Comment glutathione S-transferase Gst2 [Schizosaccharomyces japonicus yFS275]; AA=GCF_000149845.2; RF=representative genome; TAX=402676; STAX=4897; NAME=Schizosaccharomyces japonicus yFS275; strain=yFS275; AL=Scaffold; RT=Major
Sequence
MSQFTLYSLRGGPNPWKVVLIMKELNLSYETRFLDFSKKEQKSAEHIALNPNGRVPTLVD
HANNDYTVWESDAILLYLTDKYDTERRISLAHDHPEYHHELQYLFFQASGQGPMFGQAGW
FNHYHDVPIPSAVVRYRNEIKRVLGVLELIFERKEYLVDNRCTIADLSFIHWNKALTRIF
GEGKFQFTEELPTLDFEKEFPKTYAWHQRLLARPAAVATTEEYNKSQI
Download sequence
Identical sequences B6JXN9
XP_002171476.1.46972 SJAG_00179T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]