SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002172088.1.46972 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002172088.1.46972
Domain Number 1 Region: 162-260
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-30
Family Thioltransferase 0.00022
Further Details:      
 
Domain Number 2 Region: 3-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.82e-26
Family Thioltransferase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002172088.1.46972
Sequence length 262
Comment glutaredoxin Grx4 [Schizosaccharomyces japonicus yFS275]; AA=GCF_000149845.2; RF=representative genome; TAX=402676; STAX=4897; NAME=Schizosaccharomyces japonicus yFS275; strain=yFS275; AL=Scaffold; RT=Major
Sequence
MSISVDSVEQFQEIVQSNKEKTIILNFYAPWAAPCQQMNQVFDQLATEAPNAVFLKLEAE
KLPDVAEIFDVASVPLFVLIKEQQVISRISGANPQKLKEAVDEHVNKLPGAKAADASATK
STSTAASNTSAAPTAVKETAAVSAVESGEVRKEGEQESEQELNARLEKLTRAHDVMLFMK
GIPSEPACGFSRKIVALLREQGVQYGYFNILADNSVRQGLKTFSDWPTFPQLYIRGEFVG
GLDIVSEMIETGEFQQMINGSA
Download sequence
Identical sequences B6JWP4
SJAG_00822T0 XP_002172088.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]