SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002173702.1.46972 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002173702.1.46972
Domain Number 1 Region: 66-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.44e-20
Family Thioltransferase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002173702.1.46972
Sequence length 166
Comment monothiol glutaredoxin Grx3 [Schizosaccharomyces japonicus yFS275]; AA=GCF_000149845.2; RF=representative genome; TAX=402676; STAX=4897; NAME=Schizosaccharomyces japonicus yFS275; strain=yFS275; AL=Scaffold; RT=Major
Sequence
MGINRKVCVSVAILLVLSFVQLLTVCVSWDALDVKQHLHKLSKQTNNYEPSVSNAKTGTD
FASLLEPPVVIFSRTTCPYSRRAKHLLLETLDIVPKPVVIETDEHEHTDELRKWLESISG
IATVPNIFVYGQSIGGFTDVDALHSSQALESVFDRLSHGDVVIVKE
Download sequence
Identical sequences B6K2M8
SJAG_02495T0 XP_002173702.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]