SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002187674.2.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002187674.2.42559
Domain Number 1 Region: 46-541
Classification Level Classification E-value
Superfamily Sema domain 1.57e-99
Family Sema domain 0.00095
Further Details:      
 
Domain Number 2 Region: 1412-1537,1703-1860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.49e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 975-1065
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000955
Family Other IPT/TIG domains 0.089
Further Details:      
 
Domain Number 4 Region: 885-965
Classification Level Classification E-value
Superfamily E set domains 0.000000000000117
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 544-596
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000017
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1065-1148
Classification Level Classification E-value
Superfamily E set domains 0.00000000216
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002187674.2.42559
Sequence length 1927
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-D1 [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MAPAPVPAPVPAPAAGAEPRPPALLPLLLPLLPLLLPGRAAGLEVQRKFLSPTLTNNFAL
DGPGSRVYLAAVNRLFQLSGGELALEAEAAVGPVLDSPLCHAPQLPQASCEHPRVLTNNY
NKILQPDPEQGVLVVCGSIYQGLCQLRSMANISAVAVRFPPGGSDSVAVFPSMLNVAANH
PNASTVGLVLRRGGGGGARLLVAATYTGFGSPFFPRNHSLEDHRFENTPEIAIRALNARG
DLAKLFTFDINPSDDNILKIKQGDKARHKLSFVRAFLQHGAAPPARRPYAYLALNTEANA
GDKESPAHSLLARICLGEPAEATLNGSGETKKLTESYIQLGLRCGGAADAFTRLVSVFPA
RELLFGVFERAGPAGGRGRPQSALCVFRFAEIEETIRAARNSCFVSPAAGMVTVLDSVVQ
GTGPACEKRNIQLQPEQLDCGAAHLQHPLAIVNPVTATPIFTHSGLTAVAVASVNNYTVV
FLGTASGGLLKINLDSTMKVISRRSILVAYGEPVHPIMQFDPSDSTYLYLMTSYQMTRVK
VAACSQYSTCTECLAAADAYCGWCTMETRCSLQHECTNFTGANFWASVSEGVQQCPSMTI
LEPEINIDKENPALIIQINGTIPNLNGTNISCDYGNNIYTVARVAGDYVNQFIYCSLLPH
EKYPAFPDDQDHVVVETSLRVNNKNIIRANFTIYDCKRIGNIYPKRACTSCLSARWKCHW
CPSAYSCVSNRSQCEDALRMEKKIDCPQIVPAPLEPMPTGVSRNILISLANATFSKGTAL
ECHFGTDGTFEARWVNSSAVECVHVLLHTSEKSXIAPSNLQLKDKPDRFIDTPLPLNMEV
YNCATGSADCSQCLGREDLGHRCLWSETSSSCRLQTEPPQVSEVCPPPEIRKIEPLRGPL
EGGTLLTIRGRNLGRRFSDILGAVRVGGVLCAPLPDRYVVSETVVCQTGGAPEAFSDVVT
VNVSREGRSRERYSYVLPVVQSIAPQNGPKAGGTRVTIRGSRLDVGSELRVLINSSKQCT
DLSRTDSTITCTMPAVELTTAVPVCVQFENKSCASHNITFKYEKNPVISDINPKKSLISG
GRIITLEGRGFGLVQNVSMAVRGIGREHTRCKVHTDTAITCPSPAASNLTVGSKPAPVDF
YLNGRLYSDERSALDEEMYSEEASHISKFSLGYYADPQFSTAKKEKWIKHHPGEPLTLVI
HKEPDSLGLESNEYQVKIGLISCEIQIVSDRVIHCSINESLSSSERQLPVTIQVGKFNYT
IAMLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIR
EEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEECYILPSQQLS
SQVGSQVQETHPLLVGEWKIPENCRPNMEEGISLFSTLLNNKHFLIVFVHALEQQKDFAV
RDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWM
SICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNL
NVSFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNVPYSQWPRVEDVDLEWFATSTDSY
ILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDTTLSRVKDLDTEKYFHLVL
PTDESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIRDDKPPVAVK
YFFDFLEEQAEKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVI
AQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAHLA
EESRKYRNEFNTNVAMAEIYKYAKRYRSQIVAALDANPTTKRTQLQHKFEQVIALMEDNI
YESCSEA
Download sequence
Identical sequences XP_002187674.2.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]