SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002189228.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002189228.1.42559
Domain Number 1 Region: 211-273
Classification Level Classification E-value
Superfamily Homeodomain-like 1.92e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 93-159
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000167
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 62-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000111
Family LIM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002189228.1.42559
Sequence length 347
Comment PREDICTED: LIM/homeobox protein Lhx8 [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MYWKSDPMFVCRLEDKDLPALGGPAEKASPTTADEDSCSSSAALSPSSSPRSMASGSGCA
PGKCVCSSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDYF
RRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVH
YDCMLDNLKREVENGNGISVEGALLTEQDVNHPKPAKRARTSFTADQLQVMQAQFAQDNN
PDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPNHSSTAPVTAVQPSRLSPPMLEE
MAYSAYVPQDGTMLTALHSYMDAHSPTALGLQPLLPHSMTQLPLSHT
Download sequence
Identical sequences H0ZJH3
ENSTGUP00000010741 XP_002189228.1.42559 59729.ENSTGUP00000010741 ENSTGUP00000010741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]