SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002189368.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002189368.1.42559
Domain Number 1 Region: 363-373,405-601
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 2.23e-30
Family Cofactor-dependent phosphoglycerate mutase 0.049
Further Details:      
 
Domain Number 2 Region: 240-304
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000361
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 21-72
Classification Level Classification E-value
Superfamily UBA-like 0.000000000374
Family UBA domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002189368.1.42559
Sequence length 625
Comment PREDICTED: ubiquitin-associated and SH3 domain-containing protein A [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MAMAEAHLYAKVSNKPWGRSTSALLEPLLAKGFPAHIAQKALVATGQKTIEDAVKWLHSH
CNDPSLDDPIPQEYALYLCPRGRLHSRLQDFWRESKRQCGKNRAHEVFPHVTLCDFFTCE
DQKVELLYDILKQVGDSFSQIFPPSISLTLHASPSYLGFFIDGSQANVLKEFAVAFSSEA
SALADCHVKPSLKQFHLTLAHRFYPHHQKTLEQLAKHINPGEPCQWVAALYSRDMRFVHY
QRLRALFQYKPQNIDELMINAGDLIYVDPRQQSTASEGWVIGTSHRTGCRGFLPENYTER
AHESDTWVKHREYVFDTASRSFTKTENEPNVKLNGEAQNLSMSRSVTNVLSLQNTALRRG
VLVMCHGERVDQVFGKSWLQQCLTADGKYHRADLNFPSSLPRQKDNMKQFECDPPLSCCG
IFQSRLIGEALLDQEVTVSYVYSSPALRCVQTAQHILQGLKLNQKVRIKVEPGLFEWTKW
EASRAIPNFMTVAELVEASYDIDTSYRSNFPLSSLVPSESYEDYVSRSSVVIKQIISACP
CKGRGVILIVGHGSSLAPLTRALTGLPSRDSRDFVQMVQKIPSLGMCFCEEQKEENKWQM
VNPPVKTLTHGANAAFNWRNTIMED
Download sequence
Identical sequences H0Z5F3
XP_002189368.1.42559 59729.ENSTGUP00000005799 ENSTGUP00000005799 ENSTGUP00000005799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]