SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002189674.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002189674.1.42559
Domain Number 1 Region: 57-312
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-98
Family Protein kinases, catalytic subunit 0.00000959
Further Details:      
 
Domain Number 2 Region: 683-793
Classification Level Classification E-value
Superfamily KA1-like 1.8e-47
Family Kinase associated domain 1, KA1 0.00000544
Further Details:      
 
Weak hits

Sequence:  XP_002189674.1.42559
Domain Number - Region: 322-370
Classification Level Classification E-value
Superfamily UBA-like 0.00175
Family UBA domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002189674.1.42559
Sequence length 793
Comment PREDICTED: serine/threonine-protein kinase MARK1 isoform X1 [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MSTRPPLPTVSERDTENHTSVDGYTEPHIQPIKSSSRQNIPRCRNSITSTNEEHPHIGNY
RLLKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIV
KLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKCIVH
RDLKAENLLLDSDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDV
WSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRG
SLEQIMKDRWMNVGHEEEELKPYTEPEPDFNDTKRIDIMVTMGFSREEIHESLVNQKYDE
VMATYLLLGRKPPEFEAGDSLSSSNLGQRSRPSSDLNNSSVQSPAHLKVQRSISTNQKQR
RFSDHVGPSIPPAVSYTKRSQANSVESEQKEDWDKDVSRKLGSTTVGSKGEMAASPLVGP
ERKKSSAVTSNNVFSGSGMTRRNTYVCERSSDRYSAIQNGKDNSLTEMSASSTSSAGSAV
ASVSTRPRHQKSMSASGHPIKVTLPTIKDGTEGYRPSATQRVPAASPSAHSISTTTPDRT
RFPRGSSSRSTFHGEQLRERRNATYNGPPASPSHETGAFAHARRGTSTGIISKITSKFVR
RDPSEGEASGRTDTSRSVSGEPKDREKEDSKDSKPRSLRFTWSMKTTSSMDPNDMMREIR
KVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIAF
KNIASKIANELKL
Download sequence
Identical sequences H0YWZ5
59729.ENSTGUP00000002820 ENSTGUP00000002820 XP_002189674.1.42559 ENSTGUP00000002820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]