SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002192075.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002192075.1.42559
Domain Number 1 Region: 480-593
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-32
Family SH2 domain 0.000000771
Further Details:      
 
Domain Number 2 Region: 163-256
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.39e-29
Family Ras-binding domain, RBD 0.0002
Further Details:      
 
Domain Number 3 Region: 287-402
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000329
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002192075.1.42559
Sequence length 596
Comment PREDICTED: growth factor receptor-bound protein 10 isoform X1 [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MALAGCPDSFLHLPYRIDNVDQTSAHGRRDLVEPGFQEPSNRISLNHQDDDVDLEALVND
MNSSFESLYSTCSMQSETTPLLQNGQLNRSQLPSSGPSTLQPLSPRQRVQRSQPVRIMAV
RRLQEEEQQFRTSSLPAIPNPFPELCSPASSPVLAPGSLPQSQPASKHDVKVFSEDGTSK
VVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELIVQVESTMGSE
SKFLFRKNYAKYEFFKNPMNFFPEQMVAWCQQTNGSIPQSQLLQNFLNSSSCPEIQGFLH
VKELGRKSWKKLFMCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGKKLYNAPA
EYGFCIKPNRVRNETKELRLLCAEDEQSRTCWMTAFRLLKYGMLLYQNYRIPQQRKAMLP
HFSTPVRSVSENSLVAMDFSGQIGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPL
HPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQK
IKHFQILPCEDDGQIFFSLDDGNTKFSDLIQLVEFYQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences H0ZCA3
59729.ENSTGUP00000008212 ENSTGUP00000008212 XP_002192075.1.42559 ENSTGUP00000008212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]