SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002192215.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002192215.1.42559
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.09e-34
Family Cap-Gly domain 0.00059
Further Details:      
 
Domain Number 2 Region: 126-370
Classification Level Classification E-value
Superfamily L domain-like 6.12e-27
Family Internalin LRR domain 0.023
Further Details:      
 
Domain Number 3 Region: 443-529
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.28e-22
Family Ubiquitin-related 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002192215.1.42559
Sequence length 529
Comment PREDICTED: tubulin-specific chaperone E [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MAAAVPPDALGRRVACGTDYGTVRYVGSVSPTAGIWLGVEWDDPQRGKHDGSYEGTQYFK
CRHPKGGSFIRPNKANFGVDFLTAVKDRYGLNDKQDALCGTGDTVVFGTKTVEFVGMDSV
AEQQRQLNKLVDISVRECAVSHAGQEEEISRTCVNMRHINLSKNLISSWETVIAIASQVQ
NLETLNVSENKMRFPSTSTFTSSAFSNLKILALNQTEITWTEVLLCAQGWPVLEELYLSS
NNITVLERPDNVLQTLKLLDLSDNQLLDGNQLHLIAHLPRLEQLILRNTGISSIYFPDAG
FGCKTKMFPSLKRLAINENKISQWSSINELDKLPSLRALQCNNNPIMDTEKNPETLIQLI
IAKISQLEVLNNCEILPAERRGAELDYRKIFGKDWLEAGGHWNPEKNKPSEEFLAAHPRY
PILCLKYGAPEEGELKRQQPLTLKNQLLTLTIKCPEKPEQKPVEKKLPESMTIQKVKGLL
YRLFKIPGSDLKLSYKSSKLEGKEVELDNDLKPLQFYSIESGDCVLVRW
Download sequence
Identical sequences H0ZJ32
XP_002192215.1.42559 ENSTGUP00000010600 ENSTGUP00000010600 59729.ENSTGUP00000010600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]