SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002193639.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002193639.1.42559
Domain Number 1 Region: 54-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000419
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002193639.1.42559
Sequence length 151
Comment PREDICTED: epigen [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MAFGMLIYILLKAMGALSEESAITASSLSTDLRNNWTKNNAEVDYTEQPKLLKLMQTCLE
EHHSYCINGLCAFHSELRKPICKCLAGYNGERCEHLTLNSYAHNSYERYIAVGIGIGILT
SGILAIIYYYIRKRCRKLKSPYKVCVGETAL
Download sequence
Identical sequences H0YTI2
59729.ENSTGUP00000001595 ENSTGUP00000001595 XP_002193639.1.42559 ENSTGUP00000001595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]