SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002194153.2.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002194153.2.42559
Domain Number 1 Region: 431-569
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-26
Family UBX domain 0.0089
Further Details:      
 
Domain Number 2 Region: 179-288
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000321
Family Thioltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002194153.2.42559
Sequence length 684
Comment PREDICTED: UBX domain-containing protein 4 [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MSHGADSSGMFQTQNYTGLEKTSEIIEFKLTKHHVNQTMALSATSSFSSKTERNRDCTTS
LGSLFQCRGILSEKRFSLMSNLKLPWSSLRLCPIVVWLAPREKSLTHTRLHPPPRPKAAA
PFVQRQDASGLRGQDRGPPSPHHRIRPAFAGPRGGGWPQLRCAVAERGGCRRCQRCGFGG
SVPAALGPAKERSSVFVVFVAGEDEQSTEMAARWEDEKVTEAASDGFVAIKIDTKSEACL
QFSQIYPVVCVPSSFFIGDNGIPLEVIAGSVSVEELVTRIHKVKQMHTGKGQPLENGSQA
CAPCSSSQSDGALESAESGAGVCDSAEAVMPETTASSASNDEANSGQASQEATNSADEQA
NDAQPVNDLTLKVERLTKKLEERREEKRKEEEQKEIKKEIERRKTGKEMLEYKRRQEEEL
TKRMLEERNREKAEERAARERIRQQIAMDRAERAARFAKSKEEAEAAKAAALQAKQAEIE
ARKEAAQRERSAIARIQFRLPDGSSFTNQFPSEARLEEARQFAAQTVGNTYGNFSLATMF
PRREFTKEDYGKKLLELELAPSASVVLLPAGRPATSVVQASGSDLWKFLGTILYPLLAVW
RFISNFLFTSPPPSQPSVRSAHQQDHSAPSASGSTEQSRQAVRKRVVEKRGEDFKKEGKI
YRLRTQDDGEDENNTWNGNSTQQM
Download sequence
Identical sequences XP_002194153.2.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]