SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002199089.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002199089.1.42559
Domain Number 1 Region: 29-200
Classification Level Classification E-value
Superfamily MIR domain 7.06e-58
Family MIR domain 0.00000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002199089.1.42559
Sequence length 214
Comment PREDICTED: stromal cell-derived factor 2-like protein 1 [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MRGGRRLFPLLLLALLPGLCHGREPAPGAVTCGSVLKLLNTRHSVRLHSHEVKYGSGSGQ
QSVTAVEASDDANSYWRIRGKSDNGCQRGTPVKCGQAIRLTHVNTGKNLHTHHFPSPLSN
NQEVSAFGNDGEGDDLDFWIVQCSGTYWEREDAVRFKHVGTEVFLSITGEQYGHPIRGQR
EVHGMPAANHHNYWKAMEGVFIKPSLDPAKHDEL
Download sequence
Identical sequences H0ZEC0
ENSTGUP00000008932 XP_002199089.1.42559 ENSTGUP00000008932 59729.ENSTGUP00000008932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]