SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002258170.1.91479 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002258170.1.91479
Domain Number 1 Region: 109-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.48e-54
Family RecA protein-like (ATPase-domain) 0.000000118
Further Details:      
 
Domain Number 2 Region: 27-88
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000753
Family DNA repair protein Rad51, N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002258170.1.91479
Sequence length 347
Comment Meiotic recombination protein DMC1-like protein,putative [Plasmodium knowlesi strain H]; AA=GCF_000006355.1; RF=representative genome; TAX=5851; STAX=5850; NAME=Plasmodium knowlesi strain H; strain=H; AL=Chromosome; RT=Major
Sequence
MATLPSSKSTSKVAATTQMEEEVTKDHQFQEIEKLQDLGINAADINKLKGSGYCTILSLI
QATKKELCNVKGISEAKVEKILEVASKIENCSSFITANQLAHKRSKVLKITTGSSSLDRT
LGGGIESMSITELFGENRCGKTQICHTLAVSAQLPRSAGGGNGKVCYIDTEGTFRPEKIC
KIAERYGIDGEDVLDNILYARAFTHEHLYQLLAVSAAKMCEEPFALLVVDSIISLFRVDF
SGRGELSERQQKLNKTLSVLSKLGEQFNIAVLITNQVMSDPGATMTFVANPMKPVGGHVI
GHASTTRLSLRKGKGDQRVCKVYDAPNLPEVDCIFQLSEGGVIDATD
Download sequence
Identical sequences A0A1A7W2J8 A0A1Y3DXW8 B3L1D8
XP_002258170.1.91479 gi|193808003|emb|CAQ38707.1| gi|221053592|ref|XP_002258170.1| PKH_051570 5850.PKH_051570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]