SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002262385.1.91479 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002262385.1.91479
Domain Number 1 Region: 418-616
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000864
Family Regulatory subunit H of the V-type ATPase 0.057
Further Details:      
 
Domain Number 2 Region: 11-145
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000624
Family APC10-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002262385.1.91479
Sequence length 896
Comment , partial [Plasmodium knowlesi strain H]; AA=GCF_000006355.1; RF=representative genome; TAX=5851; STAX=5850; NAME=Plasmodium knowlesi strain H; strain=H; AL=Chromosome; RT=Major
Sequence
MGSKDKDNLKLKYKILSTSSNDKDHDVTNLLKNTGGEIYKPWLSGKNCIYPQEIILQIKS
SKIKYLEFLSHEYSISKKIEIFVSNDNKDYLKAGFFRFNDNTSTSYCARELKYVYLPCTI
KCTFIKLKLHNPYSNYLNTHAQVGLYYINIIPEDIPLKIMSEITPAFLKLTSLAYNRNED
YNDNMVNIKKVLLRKKGGNVHRSNISNNNVIDNFSDGETHRGSFRRSYSKGDKNKINCLY
EKLENKIKCFEELKGECVAKEEYNVASELKKIVNLFIFLKNVITFLKEKKKKYVKEENYG
KAKRLKEKEVKIKIIIKNIEELKIVDDCSRKWYYEWLSLYYKELEFYEAEINKIMSTENI
KIIKKKSGLLDQCNTKNYNGLDLKNVLLFISSDDEKKRELGFDLSYKPFEDHGKRNKNFW
HNNIEPLCLIIKRGISDPCYNIFIKSVVTLEKMLLLFQDYFVKMDNIDTDKSNSKSAEYI
KCIISALLKRLDDSNLDVVDICIKTIMMMLHNNFISFKSVFSTILSMLFYLFSGDTTSQI
NEKIIVSLMSFYYSLINKYYASVKNDINLKKVLEIISIFLEVDVEPIKQTSLDFFVNIYN
RVENKNELFEEFLLNLSFDTKNLIINRVNQEEKEKMKISIKDNNEKKEIENETPEKSCMF
VNNDELLNKNYINNRHLKTQEITPCENNIKRVHETGNIRDNVMESNKREYYSTLVKNTDD
SKQTDRHSKLTTVENSDLKKEICPSAIKELQEETENKQNEESEKPQYIDSIPGKETKTDF
IPLSGLHKKNSIGEHAKHESISKVEQNNIVKKEKAMDQGEYVEDSTRTDENNEADIPAFT
CKYCFKTDESFTEIGLEKHWIKKCPMLCTCPNCFLIVELVVIHDHFLSECSHSYMY
Download sequence
Identical sequences B3LCV4
5850.PKH_144820 PKH_144820 XP_002262385.1.91479 gi|193811535|emb|CAQ42263.1| gi|221061631|ref|XP_002262385.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]