SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002267833.2.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002267833.2.54126
Domain Number 1 Region: 92-168
Classification Level Classification E-value
Superfamily PA domain 0.000000824
Family PA domain 0.014
Further Details:      
 
Weak hits

Sequence:  XP_002267833.2.54126
Domain Number - Region: 510-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 291-394
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0249
Family Thioltransferase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002267833.2.54126
Sequence length 624
Comment PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MREKLGLLVCVWFVLWGSCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVG
TVVYPKANQKACKSFEDVEISFKSKPGGLPTFLLADRGDCFFTLKAWNAQNAGAAAILVA
DDKIEPLITMDTPEEENAHADYLQNITIPSALISKSFGDSIKNALSKGDMVNINLDWRES
LPHPDERVEYEFWTNSNDECGPKCESQIEFVKNFKGAAQIFERKGYTQFTPHYITWYCPD
AFILSKQCKSQCINHGRYCAPDPEQDFSRGYDGKDVVVQNLRQACFFKVANESGKPWLWW
DYVTDFAIRCPMKDKKYSKECADQVILSLGVDVKKIDQCIGDPEADVDNPVLKAEQDAQI
GKGSRGDVTILPTLVINNRQYRGKLDKGAVLKAICAGFQETTEPTICLSDEVETNECLEN
NGGCWQDKAANITACKDTFRGRVCECPIVQGVKFTGDGYTNCEASGALRCEINNGGCWKD
TKDGSTYSACVDDNSKGCQCPQGFKGDGVKTCEDVNECKDKVACNCPECKCKNTWGSYEC
SCSGNLLYMREHDACISKHVKTEVSWSFIWVIILGLAAAGVGGYALYKYRIRRYMDSEIR
AIMAQYMPLDNQGEIPNHVPHGDI
Download sequence
Identical sequences D7SQY6
GSVIVT01030177001 XP_002267833.2.54126 29760.GSVIVG00037498001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]