SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002270502.1.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002270502.1.54126
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily PapD-like 1.05e-44
Family MSP-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002270502.1.54126
Sequence length 238
Comment PREDICTED: vesicle-associated protein 1-1 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MSTGELLSIEPLELKFPFELKKQISCSLQLSNKTENHVVFKVKTTNPKKYCVRPNTGIVL
PRSTCDILVTMQAQKEAPSDLHCKDKFLLQSAVVTAGTSQTDITADMFNKDSGHIVEECK
LKVVYVSPPQPPSPVPEGSEEGSSPKGPSTDNGNPSGPEFASVTKALAKSQENSSETRAL
ISKLTEERNNAIRRNSKLRQELDLLKHDGKKNRGGVSFMFVAIVGLIGIIVGYFIKKT
Download sequence
Identical sequences D7TN49
29760.GSVIVG00009606001 GSVIVT01001317001 XP_002270502.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]