SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002270973.2.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002270973.2.54126
Domain Number 1 Region: 30-289
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.11e-84
Family Glycosyl hydrolases family 16 0.0000000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002270973.2.54126
Sequence length 290
Comment PREDICTED: xyloglucan endotransglucosylase/hydrolase 2 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MAPCFSLNISSMLLFSVFVSSIMAASAGSFYQDFDLTWGDHRAKILDGEKLLTLSLDKAS
GSGFQSKKEYLFGKIDMQLKLVSGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYIL
HTNVFTQGKGNREQQFYLWFDPTENFHTYSIIWNLQNIIFLVDNIPIREFKNQESIGVPF
PKSQPMRIYSSLWNADDWATRGGLVKIDWSKAPFTASYRNFNAAACLWSHGSSSCASKFT
SPVSNIAWQNQGLDAKSRRKLQWVQKNYMIYNYCSDMKRFPGGLPLECRH
Download sequence
Identical sequences XP_002270973.2.54126 29760.GSVIVG00003361001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]