SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002275489.2.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002275489.2.54126
Domain Number 1 Region: 93-192
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-23
Family B3 DNA binding domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002275489.2.54126
Sequence length 287
Comment PREDICTED: B3 domain-containing transcription factor FUS3 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MMEQNEAYALMAGVGGELSFVTVRGDKTHEGSDRSPPTRDLVAASSFGVQGRKRMPRQRR
SSAINLLTFAPSTSPHVPPPPPARAIDRKWLRFLFEKELKNSDVGSLRRMVLPKKSAETH
LPLLEAKEGILITMYDLDGQHVWNFKYRFWPNNNSRMYVLENTGEFVNVHGLQLGDYIML
YHDGQTQSLVIEARKASEKNLHADLSKNIAVSDLFLQDLEANRSNYFLAMDTGTSFVYET
TFSNDSPLDFLGGSMTNYPGGSVSNYSRFGALEGFGSVESLSLDDFC
Download sequence
Identical sequences D7SVJ3
XP_002275489.2.54126 GSVIVT01033007001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]