SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002277190.1.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002277190.1.54126
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily PapD-like 6.54e-41
Family MSP-like 0.0026
Further Details:      
 
Weak hits

Sequence:  XP_002277190.1.54126
Domain Number - Region: 198-237
Classification Level Classification E-value
Superfamily Fzo-like conserved region 0.011
Family Fzo-like conserved region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002277190.1.54126
Sequence length 293
Comment PREDICTED: vesicle-associated protein 1-2 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MELLEIQPRELKFTFELKKQSSCSIHLVNKSDQYLAFKVKTTSPKRYCVRPNTGVVKPNA
ECDVMVTMQAQRVAPPDMQCKDKFLIQSTVVPYGTTETDIRSDMFAKDSGKYLEEKKLRV
VLIGPAHSPVLLPLNGLLKQDPCHENFSQKDQLLSGVENTPPAHVVAKDVEGFKTAKVTD
ESRAAKDVESRPAEDVDELKLTNDIAKENLAKDIEELNSKLNVVELNLSEAKLIITKLTE
ERSMATREKETLKHELAMLRKKSDVRRVRVGFPFLFVLIIALIGIAAGYLMHS
Download sequence
Identical sequences D7T6K0
XP_002277190.1.54126 XP_010649789.1.54126 XP_010649790.1.54126 XP_010649792.1.54126 XP_010649794.1.54126 XP_019075251.1.54126 29760.GSVIVG00019831001 GSVIVT01017816001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]