SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002282159.3.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002282159.3.54126
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.04e-23
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 257-359
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-23
Family B3 DNA binding domain 0.0064
Further Details:      
 
Domain Number 3 Region: 487-588
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-23
Family B3 DNA binding domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002282159.3.54126
Sequence length 604
Comment PREDICTED: B3 domain-containing protein Os01g0723500 isoform X1 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MKNSKRPHFFEVFQPDASSERLKIPSRFIKHMEGRTSGFVSLVGPSDNTWHVDLIQQNSD
LLLHDGWPVFVRDHCIECGDSLVFRYDGNLHFTVQVFDRSSCEKEAAFHAKCSQDPGGLD
DPLRKKRERESPVVSKDKIFEGVPKKMRGSSCHVHSECITKNLEDKMDKSDKEACKCEDL
FMTEKCQAAVFSNETKKCGSPSKDSLSSMPSQLKACNEKPEAAIQSRADDEFDSRARGCG
CTSLLSTFEEKKVAQSFTSSFPNFVRIMKKFNISGSYTLKIPYKFSMEHLPKCKIKIVLR
NLKGDCWTVNSVPTTKVHTLHTFCGGWMAFVRGNGLKMGDICIFELVRKCEMRVHILGAG
KEGIDGQSGKTMSNGFTPGCAATSHKNPEGLPKKPKGNSSKVHLKHITKLGVSGKKGSKT
HQDTVPNEMKKHGSSSKSSVSSASKACNEKPESAIQNTTSAADDLRSQAKSFVSTISAEE
EKAVRSFTSSYPYFARFMKKFNISGSYTLKIPYQFSMAHLPKCKTEIVLRNLKGECWTVN
SVPDTKGRMVHTFCGGWMAFVRGNDVKMGDICMFELVGKSEMLVHISGVGKKGSDHQSGK
AASN
Download sequence
Identical sequences E0CPD4
GSVIVT01009586001 XP_002282159.3.54126 XP_010664617.1.54126 XP_010664618.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]