SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002284424.1.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002284424.1.54126
Domain Number 1 Region: 61-208
Classification Level Classification E-value
Superfamily PapD-like 3.14e-32
Family MSP-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002284424.1.54126
Sequence length 264
Comment PREDICTED: vesicle-associated protein 4-1 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MGIADRRKPSSEGKLWRLCPFWQSGNGSPSSSSTQNFQQHKIRGRRHVDDTDTRSSPSKV
SSVARSFLPTRRRLRLDPANNLYFPYEPGKQVKSAVRMKNTSRSHVAFKFQTTAPKSCYM
RPPGGILAPGESIIATVFKFMEHPENNEKNEKQLDQKSNVKFKIMSLKVKAGMDYVPELF
DEQKEKVSVERILHVVFLDVERPSPALEKLKRQLAEAEAAVEARKKPPPEIGPRVIGEGL
VIDEWKERREKYLAQQQVEAVDSV
Download sequence
Identical sequences A5ARH9
GSVIVT01014445001 XP_002284424.1.54126 29760.GSVIVG00027583001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]