SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002292085.1.2071 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002292085.1.2071
Domain Number 1 Region: 68-107
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000347
Family Ovomucoid domain III-like 0.013
Further Details:      
 
Domain Number 2 Region: 151-189
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000222
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002292085.1.2071
Sequence length 326
Comment predicted protein [Thalassiosira pseudonana CCMP1335]; AA=GCF_000149405.2; RF=representative genome; TAX=296543; STAX=35128; NAME=Thalassiosira pseudonana CCMP1335; strain=CCMP1335; AL=Chromosome; RT=Major
Sequence
MKFIQLLTTTPLILVLFPTNASASFLAGKYCTYTGGQCGRDKYCQLPTGECNKRIATDMM
EGNCQQPPAMCTADYNPVCGCDGKTYSNECQAFAASVSVASTGKCGNNDRDVTCTLEKGG
SASSCKSNEFCAGTDGRCFDGGNGRCTTMPDMCTLEYDPVCGCDNWTYANSCVAQSMGVN
VDYRGECEKLVGVCVPDDRPRPVRNGVRFRFNMNGEDQICTDKNSNLYEYGEFSGVIDSN
DCAEKCVNGVKSDLASALRGFDYGCSDAVCRCLYDNGTLDNRTGDSFNRTNKNYVGKGSI
TSTTKKNSYYCFKLVGAEMDEIISVA
Download sequence
Identical sequences B8C788
35128.JGI23813 XP_002292085.1.2071 jgi|Thaps3|23813|estExt_fgenesh1_pg.C_chr_80351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]