SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002309187.2.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002309187.2.11743
Domain Number 1 Region: 186-274,416-553,1048-1266
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.26e-53
Family Calcium ATPase, transmembrane domain M 0.03
Further Details:      
 
Domain Number 2 Region: 554-570,839-1045
Classification Level Classification E-value
Superfamily HAD-like 4.06e-38
Family Meta-cation ATPase, catalytic domain P 0.04
Further Details:      
 
Domain Number 3 Region: 565-595,633-845
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.05e-17
Family Metal cation-transporting ATPase, ATP-binding domain N 0.013
Further Details:      
 
Domain Number 4 Region: 270-341,374-411
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.32e-17
Family Calcium ATPase, transduction domain A 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002309187.2.11743
Sequence length 1294
Comment hypothetical protein POPTR_0006s10970g [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MTSGWPLLLSLDNSPVSEQPLPHHSGSFSALGVSRRDCSFNTSILHLAQGEPFEVDCSEK
DEGRAHFFGDTRFRSVNPVVESFDLVVNTKRLYSLKSEFFEEVPLECPKQRSKHLVWWGA
TASEMLHNNNNTTFSTGFEISRDCGNLGKPKGRSRRRSVQFDDVLREEDARFIYINDPRR
TNDQYEFTGNEIRTSKYTLITFLPKNIFIQFHRVAYLYFLAIAALNQLPPLAVFGRTVSL
FPLLFVLCVTAIKDGYEDWRRHRSDRNENNREALVLQCGQFRSKKWKKIRAGEVVKICTD
ETIPCDMVLLGTSDPSGVAYIQTMNLDGESNLKTRYARQETSLAVLEGGAISGLIRCEQP
NRNIYEFTANMEFNGQKFSLSQSNIVLRGCQLKNTGWIIGVVVYAGQETKAMLNSAASPS
KRSKLEIYMNRETLWLSIFLFIMCLVVAVGMGLWLARYEDQLDYLPYYRKRYFTPGKVYG
KRYKFYGIPMEIFFSFLSSIIVFQIMIPISLYITMELVRIGQSYFMIGDRHMFDSSSGSR
FQCRSLNINEDLGQIRYVFSDKTGTLTENKMEFRRASVNGKSYGGSSLTAEQLLEENISA
ATTQKRWKLKSTITVDSELLKLLHKDLVGDERIVAHEFFLALAACNTVIPVRTHDGFSSC
TDSQIFEDVETIDYQGESPDEQALVAAASAYGYTLFERTSGHIVIDVNGEKLRLGVLGMH
EFDSVRKRMSVVIRYPNDAVKVLVKGADSSVLSILAKDLGKDDHARRSATYSHLTEYSSQ
GLRTLVIAARDLTEEELELWQCRFDDASTSLTDRAARLRQTAALIECDLNLLGATAIEDK
LQEGVPEAIESLRQAGIKVWVLTGDKQETAMSIGLSCKLLTPDMEQIIINGNSENDCRKL
LSDAKAKCGLNLSNKGSQYLKCNAEMDYLQRPERKEEVPLALIIDGNSLVYILEKELESE
LFDIATYCKVVLCCRVAPLQKAGIVDLIKSRSDDMTLAIGDGANDVSMIQMADVGVGICG
QEGRQAVMASDFAMGQFRFLKRLLLVHGHWNYQRIGYLILYNFYRNAVFVLMLFWYILFT
AFSTTSALTDWSSVLYSVIYTSVPTIVVGILDKDLSHRTLLQYPKLYGVGYRHEAYNIRL
FWVMMADTLWQSLVLFGIPIFIYKESTIDIWSIGNLWTVAVVILVNIHLAMDVQRWVSIT
HLAVWGSVIVAFACVVVLDSIPIFPNYGTIYHLTKSPTYWLTIFLIIVSALLPRFLLKLV
HHHFWPSDIQIAREAEILGRGPDYWGSKPVGSSS
Download sequence
Identical sequences B9HDJ5
XP_002309187.2.11743 POPTR_0006s10970.1|PACid:18211818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]