SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002310483.1.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002310483.1.11743
Domain Number 1 Region: 52-114
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000614
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 674-742
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.00095
Further Details:      
 
Domain Number 3 Region: 396-484
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 4 Region: 307-375
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000119
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 5 Region: 155-233
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002310483.1.11743
Sequence length 747
Comment hypothetical protein POPTR_0007s03150g [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MASSFSPFLSPPAKRPVYYSTILPDPNPNSTNGYSANKRSKPHPSTSAAPSPVPSGHVLF
RLLCHDSRIGGIIGKGGNIIKGLQQQTGAKIRIEDAPLESPDRVITIVGSVTQSSVVFSG
IGSAIEVSKGQEALVRVFERILEVAAESDSVAGGLVSCRLLAEISSVGAVIGKGGKTVEK
IRKDCGCKVKVLIDKLPACASSNEEMIEIEGDVSAVKKGLVAVSHRLQDCQPVDKTRVIS
SKPVEAVSRVSFPEVGVEILPQHSAVRPTIAQHSVAPPTVTNSSIDYASGTHLFSLESER
VSTLDTSTPQQQVVFRILCNNDRVGGVIGKGGNIVTALQNETGATISIGPKVAGCDERLI
TVTASENPESRYSAAQKTVVLVFSRVVESVIEKGLDPGSSEGSPVSVRLVVSPNQVGCLL
GKGGTIISEMRKATSTSIRIIGRDQGNPKCVPENDHVVEILGDFLNVKDSIYHITGRLRD
NLFSSILGTPGARSSSSVLAETSPYVRSMDPVRDAKRDSLRDPLWEPLRDITRDPLRDSL
RDFMRDPLRDPLRDEFRDSLRETVRDPLREPVRDPLRGPGRGPLRELGRDSASFLQPMVG
ISHNLNRQTVITQSMDHLGFSRSLDHSPSPRLWGSQTIPGVNPRGISDLSGGLPSFKAGL
DDLVSGGKSAFVTNTTVEIVIPEHTFGSVYGENGSNLARLRQFSGAKVIVHEPRLGTSDR
IIVISGTPDETQAAQSLLHAFILTGQY
Download sequence
Identical sequences B9HEA8
XP_002310483.1.11743 3694.eugene3.00070301 POPTR_0007s03150.1|PACid:18242519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]