SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002311006.1.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002311006.1.11743
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily SNARE-like 4.88e-24
Family Synatpobrevin N-terminal domain 0.0089
Further Details:      
 
Domain Number 2 Region: 144-210
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.24e-23
Family SNARE fusion complex 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002311006.1.11743
Sequence length 238
Comment Vesicle-associated membrane protein 727 [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MSSQRGLIYSFVAKGNVVLAEHTSYSGNFSTVAVQCLQKLPSNSSKYTYSCDGHTFNFLI
DNGFVFLAVADESAGRGLPFVFLERVKDDFKQRYSASIKNEAHPLADDDDDDDLFEDRFS
VAYNLDREFGPRLKEHMQYCLNHPEEISKLSKLKAQITEVKGIMMDNIEKVLDRGERIEL
LVDKTENLQFQADSFQRQGRQLRRKMWLQNLQMKLMVGGGVLVVILILWFVACGGFKC
Download sequence
Identical sequences B9HKP0
XP_002311006.1.11743 POPTR_0008s02030.1|PACid:18248266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]