SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002311927.1.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002311927.1.11743
Domain Number 1 Region: 65-153,295-430,902-1119
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.57e-51
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 
Domain Number 2 Region: 688-753,796-901
Classification Level Classification E-value
Superfamily HAD-like 2.11e-31
Family Meta-cation ATPase, catalytic domain P 0.061
Further Details:      
 
Domain Number 3 Region: 442-458,506-706
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 8.28e-19
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0097
Further Details:      
 
Domain Number 4 Region: 149-220,253-290
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.48e-16
Family Calcium ATPase, transduction domain A 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002311927.1.11743
Sequence length 1154
Comment hypothetical protein POPTR_0008s01500g [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MDSQNPFEEEISLNQRKGGNSVREVRHGSRGGDIELLGLSQKEIGDDDARLVYLNDPVKS
NERYEFAGNSIRTSKYSVFSFLPRNLFRQFHRVAYIYFLIIAVLNQLPQLAVFGRGASIM
PLAFVLSVTAVKDAYEDWRRHRSDRVENNRLAWVLVDDEFRQKKWKDIQVGEILKIQANE
TFPCDIVLLSTSEPTGVAFVQTVNLDGESNLKTRYAKQETISKIPGEEMINGLIKCERPN
RNIYGFQANMEVDGKRLSLGPSNILLRGCELKNTAWAIGVAVYCGRETKAMLNSSGAPSK
RSQLETHMNFETIILSLFLIFLCSVVSICAAVWLRRRKDELDILPFYRRKDFAHGAPQNF
NYYGWGLEIFFTFLMSVIVFQIMIPISLYISMELVRVGQAYFMIRDMLLYDEGSNSRFQC
RSLNINEDLGQIKYVFSDKTGTLTENKMEFQRASIWGVDYSDGRTVSRNDPAQAVDGKIL
QPKMEVKVDPQLLELSRSGKDTKGAKHVHDFLLALAACNTIVPLVVDDTSDSTVKLLDYQ
GESPDEQALAYAAAAYGFMLTERTSGHIVINIQGERQRFNVLGLHEFDSDRKRMSVILGC
PDKTVKVFVKGADTSMFSVIDRSLNTNIIHATEAHLQTYSSMGLRTLVFGIRELNNSEFE
QWHLTFEAASTAIIGRAALLRKVANNVENSLTILGASAIEDKLQQGVPEAIESLRTAGIK
AWVLTGDKQETAISIGYSSKLLTSKMTSIIINSNSKQSSRKSLEDALVASKKLTITSGIT
HNTGASDAAAVNPVALIIDGTSLVHILDSELEELLFELASKCSVVLCCRVAPLQKAGIVA
LVKNRTRDMTLAIGDGANDVSMIQMADVGVGISGREGQQAVMASDFAMGQFRFLVPLLLV
HGHWNYQRMGYMILYNFYRNAVFVLVLFWYVIFTSFTLTTAITEWSSMLYSIIYTALPTI
VVGILDKDLSRRTLLKYPQLYGAGHRQEAYNSKLFWLTMIDTLWQSVAVFSIPLFAYWAS
SIDGSSIGDLWTLAVVILVNLHLAMDIFRWSWITHAVLWGSIIATFICVIVIDAVPIFTG
YWAIFHVAKTELFWLCLLAIVLAALIPRYVVKFLYQYYSPCDIQIAREAEKFGSPREPRN
TKIETNPILGSPHR
Download sequence
Identical sequences B9HKJ8
3694.estExt_fgenesh4_pg.C_LG_VIII0122 POPTR_0008s01500.1|PACid:18249078 XP_002311927.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]