SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002314641.2.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002314641.2.11743
Domain Number 1 Region: 35-98
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000048
Family SNARE fusion complex 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002314641.2.11743
Sequence length 134
Comment hypothetical protein POPTR_0010s08490g [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MYFQNDGREHRNSRTALFDDGLEEGGLRPSSSFSHETDDHDNDKAVHTLQDRVLFLKSLT
GDIHEEVESQNRLLDRMGNNMDTSRGIMSGTMDRFRMVFEKKSSRRTCALAGFFILSFLI
LYYLIRVLVYLKHG
Download sequence
Identical sequences B9HUB3
POPTR_0010s08490.1|PACid:18241926 XP_002314641.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]