SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002400016.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002400016.1.51680
Domain Number 1 Region: 73-132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000934
Family Calnexin/calreticulin 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002400016.1.51680
Sequence length 132
Comment hypothetical protein IscW_ISCW013309 [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MDTTTISEVHDEKESIQEAYFDLIPLLLVPRVLCDGEGAKEPKAEPVENIACNIPKPMEF
SQIAEHCDDLHAFKERWILSGATKDGAEDSVAKYDSKWQVEAAAQIRLRGGLGPVLKTMV
RHHAIIAKLDKP
Download sequence
Identical sequences B7QA76
6945.ISCW013309-PA XP_002400016.1.51680 ISCW013309-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]