SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002401136.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002401136.1.51680
Domain Number - Region: 24-103
Classification Level Classification E-value
Superfamily NHL repeat 0.0288
Family NHL repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002401136.1.51680
Sequence length 616
Comment conserved hypothetical protein, partial [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
FAMADEKGYFLELSSNPIRFEPVSKITNVFFDDANQQVFAVRSGGATGVVVKGPDDSKST
DFSMDDKGDVISIKFSPDLKILAIQRSQKSVEFVNFSGSVDSRNEGMTFQKGEVPIVRDS
IIIFISFNICCVAFLKRFKVPTRSHTHHSSCFGGDQSGNFSLGNILHPFQFKPGIATRLP
KFEVDLPIIPKPPRVCLLERDVTAAVLYGKCAIVVLRHQARTSVGGAGAEIVVYTLQKEG
PPRKTDLLKLDTSGRFAVNVVDSLIIVHHQASKRSMLFDIRIPGISDGFVSHHRPVVPAS
PIKPFKLKVPMVPNNSLEEVSYELYSPNWVVFQPNIVIDAKIGCLWYVQLSLEPLLAHFD
DKRKLVDFLLQRSNSKEVLLGVCRRLLAKGSELPLEQLADVFDKLAAKEGCVEPSDMYAH
VFSEFADEAEDRHHFVVSTLVEYIRSLVEHRVAVPYCLNELLINVLVRNRRFHQLHQFLQ
YHVLTDTKPLACLLLSLHTLYPPATQLALDMLKRLGTANEEIVEVLLSQHKVLSAIRFVQ
NTGGTDAISARKFLEAARSHDDDTVFYAVFKFFEHRNVALRGKPEFAKGEHCEQYVKHFE
TLYGEPTATATTAAAT
Download sequence
Identical sequences B7QG37
XP_002401136.1.51680 6945.ISCW013040-PA ISCW013040-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]