SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002401313.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002401313.1.51680
Domain Number 1 Region: 280-405
Classification Level Classification E-value
Superfamily NHL repeat 1.52e-23
Family NHL repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 174-229
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000229
Family B-box zinc-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 26-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000209
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002401313.1.51680
Sequence length 405
Comment conserved hypothetical protein [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MQEVQREPRFSPVSAGFGASRGDLAGLSCSRCRGSRVNVSVLPCFHTFCPKCLDEVSDKG
DPLGHCKCPVCEDGLDSYAFSQSIIISNILNVVKEDYETGTAVPVAANPVLDYGPCSGCD
EHIRAAGRCRDCNEMLCENCVWAHQRVRLTKEHTIIHFEEESQGQQGAAHKAPAGPPTYC
CEKHDREVLRLYCETCSQALCRECTMKEHLGHSFVYLQDAVKAARTAAPATLADVRALAD
ALEEGVERSRLMSERLRLRTQSVAAETARSSTKYGFDGPLWKQFDSPRGVAFIGDGHMVV
TDFNNHRVLVIRPDFQSASYLGLEGKDPGLFQRPQGLAVDLEGHIVVADSRNHRVQVFRP
DGKLLAWFGQQGKERGQLELPSGICIAPDGRIVVVDFGNNRVQVF
Download sequence
Identical sequences B7QG92
6945.ISCW011914-PA ISCW011914-PA XP_002401313.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]