SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002404189.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002404189.1.51680
Domain Number 1 Region: 150-293
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000629
Family Fibronectin type III 0.0081
Further Details:      
 
Weak hits

Sequence:  XP_002404189.1.51680
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000213
Family Fibronectin type III 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002404189.1.51680
Sequence length 319
Comment hypothetical protein IscW_ISCW010901 [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MLDTYLVRCCVERESKCVEVETTNNSVMVSNLYADTVYTVYVGAVLMGLGWGKNDIARSS
RGPGTQQRREGDGSKADGNGIPGGCGAPPKPTSTHRAMRNPPQVTARVCAGGRTFPVPAS
PSIEFIGNNARTSVFTWNFKDTEMIYIQVSLDNSTWLNCSVEADKCRISRLTESTLFDSS
GITTINDLAPGVTHTVFLRGCNFLGCGMSNSSEVHVPELVPRDPTNVTFTVLPNNTAVVK
WIGHSTLWDSSPPYDVTWKCGNGPKMVMITTLNTLSIHDFIDADCQVWVTAVSSWRDLYV
HRSQEVRAVVQNDQYSKES
Download sequence
Identical sequences B7Q7L6
XP_002404189.1.51680 6945.ISCW010901-PA ISCW010901-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]