SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002404226.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002404226.1.51680
Domain Number - Region: 42-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000384
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002404226.1.51680
Sequence length 254
Comment secreted protein, putative, partial [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
CLIALSNVALLLLLPSVSASADFRFPDYRRLICAGFIQLSDQSCSTGWNCYRFAKGSFCQ
DGFCVCRFGYSFGLRNGRLQCVGGLTFGESCSDQRPCSTISRTFCYNGSCLCEEDYVFYE
DRCERQAMFSKHDVDSYVSPPTRFNLLTILIIVAILVVALLFLVNKRSLFFYFPCCMRDT
VNIPGILQAESGASTNHPVNAGILGTTLSPRICVFGKSMWNLYKPPSYMETVLNVQYLPS
YQEAANLPPSPKPS
Download sequence
Identical sequences B7Q7N1
6945.ISCW020889-PA XP_002404226.1.51680 ISCW020889-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]