SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002407473.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002407473.1.51680
Domain Number 1 Region: 146-205
Classification Level Classification E-value
Superfamily E set domains 0.00000000227
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number 2 Region: 297-372
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000288
Family NHL repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002407473.1.51680
Sequence length 393
Comment hypothetical protein IscW_ISCW020206 [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MGEDDDGIRHLRSLRKMLYIQKDEAYAQIKQEVADLQQKLLKQLDTAFEIKLVELKKLEE
KVQSCSLSLNPLHFFSSIAVKSLLSLDCLKVSDFECTSFAYINACEAKPDQLHFVDDYSA
RVSNTGDTVRVYYMCSLDYDPVLFKFLTVLVKDAANNDISLKHCDLGNGCYMLEFRACEE
GSFLVCVKVYGQNISGSPVVISIQNGDSVLLPELSRSDIQGDDSGFPFELTQSGMEVTLP
ELSQTCVEVTLPKLSRSCVKRRMARKGKSALDHEEVVQGTVSADLVLEFKAYSKNDYLNF
PIGVTATSGGNIIVGDTGNHRVIVFNAEGRPLCKAALPGTVRFRRPSAVVALDDGSFAVK
DDRCVYLFSKAGEYIRTLGKDSLVRPFGKLAYE
Download sequence
Identical sequences B7Q0E4
XP_002407473.1.51680 ISCW020206-PA 6945.ISCW020206-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]