SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002409186.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002409186.1.51680
Domain Number - Region: 98-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000652
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002409186.1.51680
Sequence length 390
Comment conserved hypothetical protein [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MISLEALLNNITVRAVLTYGSRPRLRHDERDWDWGSTFAVNTSSVGSATAEIHLPYPEAG
LWYLGLLPLCYLEDRRNASVPDWVPCEYESLSVELSINSSACLNQKCGLFGRCFQYISGG
IIFSSCYCSSGYRGWGCTDSTEAQSYNHMLIELLLLTLSNLFFLPAILLAVIRRHFLEAL
VYTATMFSSAFYHACDADLSVICVLRPSVLQYCDFLTATVSLWVTLLCLADLSAPARTLV
STFGVLCIAIAVENDRMGLIVIALPVAFGLTLVFVSWMRQCFVRRSCFPRSKIWLLSIVP
GAALAVIGVVLYTGFETRRNYAYVHSAWHALVGLSLFVVLPGRRKSLDGDLKPDPINPCS
YVRVEELSDMTPTPEPASTARSQLVPPGTA
Download sequence
Identical sequences B7Q1A7
XP_002409186.1.51680 ISCW009484-PA 6945.ISCW009484-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]